LL-37
| Name | LL-37 | |
| Type | Peptide API | |
| CAS | 154947-66-7 | |
| Purity % (HPLC) | > 99.0% (HPLC) | |
| Pack size | Price ( USD ) | Inventory |
| 1 gram | US$ 670.0 | In stock |
| 50 gram | Please inquire | In stock |
Omizzur Biotech Online Inquiry Form
Notice:
1.Omizzur follows strict guidelines on the use of private information.
2.For bulk inquiry or custom packaging: [email protected]
3.Our customer service staff will contact you in 1 hour. Please check your email

General Description
LL-37 is a cationic antimicrobial peptide composed of 37 amino acids, possessing multiple functions such as broad-spectrum antibacterial activity, immune regulation, and tissue repair promotion. Its unique α-helical structure can disrupt microbial cell membranes and modulate inflammatory balance, demonstrating significant potential in the fields of infection prevention, wound healing, and tumor therapy.
LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, exhibiting potent chemotactic and immunomodulatory properties.
>>Omizzur Hot Peptide Catalog
| Retatrutide | Tirzepatide | Semaglutide | Cagrilintide |
| BPC-157 | TB-500 | Semax | Selank |
| Thymosin alpha-1 | DSIP | FOXO4-DRI | AOD-9604 |
| MOTS-c | Epitalon | Kisspeptin-10 | Vasoactive intestinal peptide |
| CJC 1295 DAC | Ipamorelin | KPV | GHK-CU |
| Dihexa | Melanotan II | LL-37 | PT-141 |
| SS-31 | Gonadorelin | Thymopentin | Cetrorelix |
| Eptifibatide | Linaclotide | Octreotide | P 21 peptide |
| MGF | 5-Amino-1MQ | Leuprolide | SNAP-8 |
| Liraglutide | Exenatide | Pinealon | Glutathione |
| Nonapeptide-1 | Sermorelin | Acetyl Hexapeptide-8 | Bronchogen |
| Oxytocin | Palmitoyl Tetrapeptide-7 | Matrixy | Mazdutide |
*** For more peptide catalog please get in touth with Omizzur team: [email protected]
The main research directions of LL-37 antimicrobial peptide in clinical practice
As a core effector molecule of the natural immune system, LL-37 has become a hot topic in clinical research due to its multifunctionality. Its research direction covers multiple fields such as anti infection, immune regulation, tumor treatment, tissue repair, etc.
1. Treatment and prevention of infectious diseases
2. Regulation of Autoimmunity and Inflammatory Diseases
3. Bidirectional regulation of tumor treatment
4. Organizational Repair and Regenerative Medicine
5. Metabolic and neurodegenerative diseases
Real product photos of Omizzur LL-37 peptide raw materials products

Product Data Sheet
| Name | LL-37 |
| CAS | 154947-66-7 |
| Alias | cathelicidin antimicrobial peptide |
| Source | Synthetic peptide |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493.33 |
| Sequence | LLGDFRKKIEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Appearance | White powder |
| Purity(HPLC) | >99.0% |
| Packing specifications | 1g/5g/10g/custom-made |
| Shipping | FedEx/DHL/EMS/By air |
| Delivery time | 5~10 days normally |
| Analysis data | HPLC,MS,COA. Accept certification |
| Storage | Store at 2-8 C or-20 C in the dark. |
LL-37 Safety Statement
For scientific research purposes only: not suitable for clinical, diagnostic, or therapeutic use on the human body; Non dietary supplements/drugs
Shipping & Storage

Ordering Guide:
Order LL-37 API now:
1. Click to send inqauiry online: Make Inquiry Now
2. Send mail to us: [email protected]
* Please mail us your address and quantity needed, Omizzur services will get back to you within 1~2 hours.
Customer also viewed
CJC-1295 without DAC
CAS:863288-34-0
AOD-9604
CAS:221231-10-3
Kisspeptin-10
CAS:374675-21-5
Thymosin Alpha-1
CAS:62304-98-7
Enquiry & Ordering Form
Method 1
Simply email to [email protected] ,you will get a fast response within 1 hour.
Method 2
Submit the simple form to get the latest quotation. Notice:Omizzur follows strict guidelines on the use of private information.
Copyright © 2020 Omizzur Inc | Terms & Conditions | Privacy Notice | Sitemap